Fam107b Rabbit Polyclonal Antibody TA332252 from OriGene Technologies | Biocompare.com

Supplier Images

Fam107b Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
Fam107b Rabbit Polyclonal Antibody

The Fam107b Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to FAM107B. This antibody recognizes Rat antigen. The Fam107b Rabbit Polyclonal Antibody has been validated for the following applications: Western Blot.

Description

Rabbit Polyclonal Anti-Fam107b Antibody

Product Specs
ItemFam107b Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA332252
Quantity100 µl
ApplicationsWB
Conjugate/TagUnconjugated
ReactivityRat
TargetFam107b
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for Anti-Fam107b Antibody is: synthetic peptide directed towards the middle region of Rat Fam107b. Synthetic peptide located within the following region: PELQKVMEKRRRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQK
NCBI Full Gene Namefamily with sequence similarity 107, member B
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!